C9orf75 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of C9orf75 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf75

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: PPFLPAASEEAEPAEGLRVPGLAKNSREYVRPGLPVTFIDEVDSEEAPQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 650

Purification: Affinity Purified

• SKU: AVIARP55691_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55691_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 286262
• Host: Rabbit