C9orf95 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of C9orf95 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C9orf95

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nicotinamide riboside kinase 1

Protein Size: 199

Purification: Affinity Purified

• SKU: AVIARP57055_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57055_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54981
• Host: Rabbit