CAB39 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAB39

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcium-binding protein 39

Protein Size: 341

Purification: Affinity Purified

• SKU: AVIARP56877_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56877_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51719
• Host: Rabbit