CALB2 Antibody - N-terminal region : Biotin

CALB2 Antibody - N-terminal region : Biotin
SKU
AVIARP58600_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALB2

Key Reference: Alaeddini,M., (2008) Histopathology 52 (3), 299-304

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calretinin

Protein Size: 271

Purification: Affinity Purified
More Information
SKU AVIARP58600_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58600_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 794
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×