CALB2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CALB2 is an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALB2

Key Reference: Alaeddini,M., (2008) Histopathology 52 (3), 299-304

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calretinin

Protein Size: 271

Purification: Affinity Purified

• SKU: AVIARP58600_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58600_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 794
• Host: Rabbit
• Conjugate: Conjugated, FITC