CALCOCO1 Antibody - N-terminal region : FITC

CALCOCO1 Antibody - N-terminal region : FITC
SKU
AVIARP57483_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CALCOCO1 functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR).CALCOCO1 is recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation CALCOCO1 acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. CALCOCO1 is involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. CALCOCO1 functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CALCOCO1

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-binding and coiled-coil domain-containing protein 1

Protein Size: 691

Purification: Affinity Purified
More Information
SKU AVIARP57483_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57483_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57658
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×