CAMK1D Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAMK1D

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium/calmodulin-dependent protein kinase type 1D

Protein Size: 385

Purification: Affinity Purified

• SKU: AVIARP57405_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57405_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57118
• Host: Rabbit