CAMK1G Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMK1G

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcium/calmodulin-dependent protein kinase type 1G

Protein Size: 476

Purification: Affinity Purified

• SKU: AVIARP57417_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57417_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57172
• Host: Rabbit