CAMKV Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: CAMKV does not appear to have detectable kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAMKV

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: LATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAGYAQESQREEAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 473

Purification: Affinity purified

• SKU: AVIARP58882_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58882_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79012
• Host: Rabbit
• Conjugate: Conjugated, Biotin