CAMKV Antibody - N-terminal region : Biotin

CAMKV Antibody - N-terminal region : Biotin
SKU
AVIARP58602_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CAMKV does not appear to have detectable kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKV

Key Reference: Ballif,B.A., (2004) Mol. Cell Proteomics 3 (11), 1093-1101

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CaM kinase-like vesicle-associated protein

Protein Size: 501

Purification: Affinity Purified
More Information
SKU AVIARP58602_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58602_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79012
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×