CAMKV Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CAMKV does not appear to have detectable kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKV

Key Reference: Ballif,B.A., (2004) Mol. Cell Proteomics 3 (11), 1093-1101

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: NRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CaM kinase-like vesicle-associated protein

Protein Size: 501

Purification: Affinity Purified

• SKU: AVIARP58602_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58602_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79012
• Host: Rabbit