CASP10 Antibody - c-terminal region : Biotin

CASP10 Antibody - c-terminal region : Biotin
SKU
AVIARP58999_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with type IIA autoimmune lymphoproliferative syndrome, non-Hodgkin lymphoma and gastric cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the c-terminal region of Human CASP10

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: QSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-10

Protein Size: 522

Purification: Affinity Purified
More Information
SKU AVIARP58999_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58999_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 843
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×