CASP10 Antibody - c-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with type IIA autoimmune lymphoproliferative syndrome, non-Hodgkin lymphoma and gastric cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the c-terminal region of Human CASP10

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: QSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Caspase-10

Protein Size: 522

Purification: Affinity Purified

• SKU: AVIARP58999_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58999_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 843
• Host: Rabbit
• Conjugate: Conjugated, HRP