Casp2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Casp2 is involved in the activation cascade of caspases responsible for apoptosis execution. It might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. It may be important in multistep carcinogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Casp2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHTQSPGCEESDAGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-2

Protein Size: 452

Purification: Affinity Purified

• SKU: AVIARP58986_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58986_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 12366
• Host: Rabbit
• Conjugate: Conjugated, FITC