CASP5 Antibody - middle region : HRP

CASP5 Antibody - middle region : HRP
SKU
AVIARP58992_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP5

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Caspase-5

Protein Size: 376

Purification: Affinity Purified
More Information
SKU AVIARP58992_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58992_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 838
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×