CASP6 Antibody - middle region : FITC

CASP6 Antibody - middle region : FITC
SKU
AVIARP58994_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in two transcript variants that encode different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP6

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: QACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Caspase-6

Protein Size: 293

Purification: Affinity Purified
More Information
SKU AVIARP58994_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58994_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 839
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×