CAT Antibody - middle region : Biotin

CAT Antibody - middle region : Biotin
SKU
AVIARP58437_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide t

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAT

Key Reference: Holt,M., (2006) J. Biol. Chem. 281 (25), 17076-17083

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Catalase

Protein Size: 527

Purification: Affinity Purified
More Information
SKU AVIARP58437_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58437_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 847
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×