CAT Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide t

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAT

Key Reference: Holt,M., (2006) J. Biol. Chem. 281 (25), 17076-17083

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Catalase

Protein Size: 527

Purification: Affinity Purified

• SKU: AVIARP58437_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58437_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 847
• Host: Rabbit