CATIP Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf62

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ciliogenesis-associated TTC17-interacting protein

Protein Size: 387

Purification: Affinity Purified

• SKU: AVIARP55902_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55902_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 375307
• Host: Rabbit