CBX2 Antibody - middle region : Biotin

CBX2 Antibody - middle region : Biotin
SKU
AVIARP58370_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CBX2 Contains 1 A.T hook DNA-binding domain and 1 chromo domain. CBX2 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CBX2

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: SDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Chromobox protein homolog 2

Protein Size: 532

Purification: Affinity Purified
More Information
SKU AVIARP58370_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58370_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 84733
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×