CCDC181 Antibody - N-terminal region : Biotin

CCDC181 Antibody - N-terminal region : Biotin
SKU
AVIARP57521_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CC181

Key Reference: N/A

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: SPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: coiled-coil domain-containing protein 181

Protein Size: 509

Purification: Affinity purified
More Information
SKU AVIARP57521_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57521_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57821
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×