CCDC197 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf48

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: uncharacterized protein CCDC197; putative uncharacterized protein CCDC197

Protein Size: 140

Purification: Affinity Purified

• SKU: AVIARP55545_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55545_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 256369
• Host: Rabbit