CCDC28A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is located in a region close to the locus of the pseudogene of chemokine (C-C motif) receptor-like 1 on chromosome 6. The specific function of this gene has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC28A

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: ERGLLSLLNDFHSGKLQAFGNECSIEQMEHVRGMQEKLARLNLELYGELE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 28A

Protein Size: 274

Purification: Affinity Purified

• SKU: AVIARP55253_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55253_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 25901
• Host: Rabbit