CCDC54 Antibody - N-terminal region : Biotin

CCDC54 Antibody - N-terminal region : Biotin
SKU
AVIARP58605_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of CCDC54 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC54

Key Reference: Dadabayev,A.R., (2005) Am. J. Hematol. 80 (1), 6-11

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 54

Protein Size: 328

Purification: Affinity Purified
More Information
SKU AVIARP58605_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58605_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 84692
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×