CCDC69 Antibody - middle region : Biotin

CCDC69 Antibody - middle region : Biotin
SKU
AVIARP55307_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of CCDC69 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC69

Key Reference: Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPVTPTEVSFLAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 69

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP55307_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55307_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26112
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×