CCDC7 Antibody - N-terminal region : Biotin

CCDC7 Antibody - N-terminal region : Biotin
SKU
AVIARP54463_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The exact function of CCDC7 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 7

Protein Size: 486

Purification: Affinity Purified
More Information
SKU AVIARP54463_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54463_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221016
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×