CCDC7 Antibody - N-terminal region : HRP

CCDC7 Antibody - N-terminal region : HRP
SKU
AVIARP54463_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of CCDC7 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 7

Protein Size: 486

Purification: Affinity Purified
More Information
SKU AVIARP54463_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54463_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221016
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×