CCDC74A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of CCDC74A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC74A

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 74A

Protein Size: 378

Purification: Affinity Purified

• SKU: AVIARP58438_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58438_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 90557
• Host: Rabbit
• Conjugate: Conjugated, HRP