CCDC74A Antibody - middle region : HRP

CCDC74A Antibody - middle region : HRP
SKU
AVIARP58438_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of CCDC74A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC74A

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Coiled-coil domain-containing protein 74A

Protein Size: 378

Purification: Affinity Purified
More Information
SKU AVIARP58438_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58438_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 90557
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×