CCDC76 Antibody - N-terminal region : HRP

CCDC76 Antibody - N-terminal region : HRP
SKU
AVIARP57327_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC76

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tRNA guanosine-2'-O-methyltransferase TRM13 homolog

Protein Size: 481

Purification: Affinity Purified
More Information
SKU AVIARP57327_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57327_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54482
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×