CCDC87 Antibody - C-terminal region : Biotin

CCDC87 Antibody - C-terminal region : Biotin
SKU
AVIARP57158_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCDC87

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLARLEWFEGQASNPNRFFKKTNLSSSHFLEENQVRSHLHRKLNLMESS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coiled-coil domain-containing protein 87

Protein Size: 849

Purification: Affinity Purified
More Information
SKU AVIARP57158_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57158_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55231
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×