CCNDBP1 Antibody - middle region : FITC

CCNDBP1 Antibody - middle region : FITC
SKU
AVIARP55414_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-D1-binding protein 1

Protein Size: 360

Purification: Affinity Purified
More Information
SKU AVIARP55414_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55414_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23582
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×