CCNDBP1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Several alternatively spliced variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCNDBP1

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCMNRIKELTQS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 232

Purification: Affinity Purified

• SKU: AVIARP55415_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55415_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23582
• Host: Rabbit