CD27 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD27

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CD27 antigen

Protein Size: 260

Purification: Affinity Purified

• SKU: AVIARP59093_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59093_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 939
• Host: Rabbit
• Conjugate: Conjugated, Biotin