CD38 Antibody - C-terminal region : Biotin

CD38 Antibody - C-terminal region : Biotin
SKU
AVIARP59103_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CD38

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosyl cyclase 1

Protein Size: 300

Purification: Affinity Purified
More Information
SKU AVIARP59103_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59103_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 952
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×