CD5 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CD5

Key Reference: Siderovski,D.P., (2008) J. Mol. Biol. 378 (1), 129-144

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-cell surface glycoprotein CD5

Protein Size: 495

Purification: Affinity Purified

• SKU: AVIARP58440_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58440_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 921
• Host: Rabbit