CD7 Antibody - middle region : HRP

CD7 Antibody - middle region : HRP
SKU
AVIARP59112_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq]

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD7

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-cell antigen CD7

Protein Size: 240

Purification: Affinity Purified
More Information
SKU AVIARP59112_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59112_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 924
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×