CD8A Antibody - middle region : Biotin

CD8A Antibody - middle region : Biotin
SKU
AVIARP59113_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a corepressor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains, or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain isoforms. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD8A

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell surface glycoprotein CD8 alpha chain

Protein Size: 235

Purification: Affinity Purified
More Information
SKU AVIARP59113_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59113_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 925
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×