CDC2 Antibody - middle region : Biotin

CDC2 Antibody - middle region : Biotin
SKU
AVIARP58401_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDC2

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-dependent kinase 1

Protein Size: 240

Purification: Affinity Purified
More Information
SKU AVIARP58401_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58401_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 983
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×