CDC42EP4 Antibody - N-terminal region : HRP

CDC42EP4 Antibody - N-terminal region : HRP
SKU
AVIARP54839_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CDC42EP4 is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. The protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, the protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDC42EP4

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cdc42 effector protein 4

Protein Size: 356

Purification: Affinity Purified
More Information
SKU AVIARP54839_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54839_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23580
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×