CDCA5 Antibody - middle region : Biotin

CDCA5 Antibody - middle region : Biotin
SKU
AVIARP58264_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA5

Key Reference: Schmitz,J., (2007) Curr. Biol. 17 (7), 630-636

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sororin

Protein Size: 252

Purification: Affinity Purified
More Information
SKU AVIARP58264_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58264_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 113130
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×