CDRT4 Antibody - middle region : Biotin

CDRT4 Antibody - middle region : Biotin
SKU
AVIARP55668_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of CDRT4 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDRT4

Key Reference: Inoue,K., (2001) Genome Res. 11 (6), 1018-1033

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CMT1A duplicated region transcript 4 protein

Protein Size: 151

Purification: Affinity Purified
More Information
SKU AVIARP55668_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55668_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284040
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×