CELA2A Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human CELA2A

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAGGDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: chymotrypsin-like elastase family member 2A

Protein Size: 269

Purification: Affinity Purified

• SKU: AVIARP57697_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57697_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 63036
• Host: Rabbit