Cela3b Antibody - middle region : HRP

Cela3b Antibody - middle region : HRP
SKU
AVIARP54812_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Cela3b

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: PNGAPCYISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDWWGFSVKKT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Elastase 3B, pancreatic (Predicted), isoform CRA_b EMBL EDL80838.1

Protein Size: 269

Purification: Affinity Purified
More Information
SKU AVIARP54812_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54812_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 298567
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×