CENPI Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI

Key Reference: Izuta,H., (2006) Genes Cells 11 (6), 673-684

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centromere protein I

Protein Size: 756

Purification: Affinity Purified

• SKU: AVIARP54805_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54805_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunofluorescence, Western Blotting
• Human Gene ID: 2491
• Host: Rabbit