CENPI Antibody - N-terminal region : HRP

CENPI Antibody - N-terminal region : HRP
SKU
AVIARP54806_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CENPI

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: SKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centromere protein I

Protein Size: 522

Purification: Affinity Purified
More Information
SKU AVIARP54806_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54806_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2491
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×