CENPN Antibody - middle region : Biotin

CENPN Antibody - middle region : Biotin
SKU
AVIARP57258_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CENPN

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 353

Purification: Affinity Purified
More Information
SKU AVIARP57258_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57258_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Immunofluorescence, Western Blotting
Human Gene ID 55839
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×