CENPQ Antibody - N-terminal region : HRP

CENPQ Antibody - N-terminal region : HRP
SKU
AVIARP57121_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPQ

Key Reference: 0

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centromere protein Q

Protein Size: 268

Purification: Affinity Purified
More Information
SKU AVIARP57121_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57121_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55166
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×