CEP70 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CEP70 plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, it is required for the organization and orientation of the mitotic spindle.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP70

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centrosomal protein of 70 kDa

Protein Size: 212

Purification: Affinity Purified

• SKU: AVIARP58607_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58607_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 80321
• Host: Rabbit
• Conjugate: Conjugated, HRP