CEP72 Antibody - middle region : Biotin

CEP72 Antibody - middle region : Biotin
SKU
AVIARP57128_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The product of this gene is a member of the leucine-rich-repeat (LRR) superfamily of proteins. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CEP72

Key Reference: N/A

Molecular Weight: 21 kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLTGLKSLDLSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Centrosomal protein of 72 kDa

Protein Size: 193

Purification: Affinity purified
More Information
SKU AVIARP57128_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57128_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55722
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×