CEP72 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene is a member of the leucine-rich-repeat (LRR) superfamily of proteins. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CEP72

Key Reference: N/A

Molecular Weight: 21 kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLTGLKSLDLSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centrosomal protein of 72 kDa

Protein Size: 193

Purification: Affinity purified

• SKU: AVIARP57128_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57128_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55722
• Host: Rabbit